PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016489728.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 219aa    MW: 24819.6 Da    PI: 9.7132
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016489728.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.81.4e-181659245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    +ie k   qvtf kRr g++KKA+EL++LC++e+a+i+f +  k
  XP_016489728.1 16 KIEVKNHLQVTFLKRRSGLFKKASELCILCGVEIAIIVFFPVRK 59
                    58888899******************************976555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-23766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.376767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-23883IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-15929IPR002100Transcription factor, MADS-box
PfamPF003191.2E-191663IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-152944IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-154465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MAKKPSIGRQ KIKIAKIEVK NHLQVTFLKR RSGLFKKASE LCILCGVEIA IIVFFPVRKV  60
LSFGHLNVES IIDRFLSRNH NPISNSSPHL VEAHQNASVH ELNLQLTQIL AELEVEKKRG  120
ESLDEMRKTS QSQYCWEAPI SKLTLHELEQ LTDSMVVLKK NVTNQASKFM VETTANSSSY  180
FRVNGNWIFD SYDIKPAQNM VASNNLHNHN FGVDSAGLF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624741.11e-162PREDICTED: agamous-like MADS-box protein AGL62
RefseqXP_016489728.11e-162PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK24e-49AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLM1DUY31e-117M1DUY3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000948161e-117(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-50AGAMOUS-like 62